PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g046550.1
Common NameMTR_2g046550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 1026aa    MW: 112971 Da    PI: 6.8176
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g046550.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.41.3e-40138215178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+C+adls+ak+yhrrhkvC+vhska+++lv  ++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Medtr2g046550.1 138 VCQVEDCRADLSNAKDYHRRHKVCDVHSKASKALVGSVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 215
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-32133200IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.197136213IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-37137218IPR004333Transcription factor, SBP-box
PfamPF031101.2E-28139212IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.24E-8790906IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.4E-6795905IPR020683Ankyrin repeat-containing domain
CDDcd002042.87E-7795905No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1026 aa     Download sequence    Send to blast
MDADFEGKNQ HLYEAVVPEM KGAVGRGSKD WDLNDWRWDG DLFTAKQLNS VPTDCRNRQF  60
LPEIRENVDV SNNLISGEGS RELEKRRRGF GGEGLEMNDD FGSLNLNLGG QVYPIMDGEE  120
KSGKKTKIAP VPTSNRAVCQ VEDCRADLSN AKDYHRRHKV CDVHSKASKA LVGSVMQRFC  180
QQCSRFHVLQ EFDEGKRSCR RRLAGHNKRR RKTHPDTAVV NGGSPNEERG SSYLLMSLLR  240
ILSNMHSNGP DHTRNLDGLS HLIGNLTSLA GTFNGRNIAS LLEGPQELVK AGTSGAAQNV  300
PNSNPNGAEP SRPDSSIEMT NGLIHQDPPE SRLQCATVPA NHLTQKCIPS SSVGVGCLKP  360
PLIPQSSNLV PSRGSLPPRP VATETTVGRN RLCNIDLNNV YDDGQDYVEN PENSNPPLAL  420
GVESRDHSSF VQYESLKSSP PQTSRNSDST STQSPSSSSG EGQSRTDRIV FKLFGKDPND  480
IPHVLRSQVL SWLSNSPTEI ESYIRPGCII LTICLRLENS AWDELCYNLG PSLRKLLAAS  540
NDSLWRTGWI YTRVQHSVAI LYNGQLVLDV PSRLGSPQNC QILCIKPLAV SANEDVKFTV  600
KGLSLFLSSA RLLCALEGKY LVEDMCYDLI DGADAAIGHH ELQTLSFSCH IPNMTGRGFI  660
EVEDNSLSSC SFPFIVAEQE ICSEICSLET IIEAAETADD IQIKAKLMEE KTRAMNFVQE  720
MGWLLHRIRI KFRLGPMTPV QDRFHLNRYT WLVGFSMDHD WCAVMKKLLD TIFEGEVDTG  780
EHISAELALL NMGLLHKAVK RNCRPMVELL LNFVPVKASD GGDSKEMQVN KVPDGFLFRP  840
DTVGPAGLTP LHVAASMNGY ETVLDALTDD PGMVGIEAWK SAKDNTGLTP NDYASLRGHY  900
SYIQLVQRKT SKSSQTQHVL DIPGTLVDGN TMKQSDGHKS SKVLSLHTEK IATTAIPNHC  960
GICQQKLAYG SVGGMRRALV YRPAMLSMVA IAAVCVCVAL LFKSSPRVSY VFQPFSWESL  1020
DYGSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-33133212584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207213KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013463701.10.0squamosa promoter-binding-like protein
TrEMBLA0A072V7X40.0A0A072V7X4_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA09G09790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]